Spiur.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title اسپیور – عصاره ای از طبیعت و دانش
Description N/A
Keywords N/A
Server Information
WebSite spiur favicon www.spiur.com
Host IP 104.27.158.84
Location United States
Related Websites
Site Rank
More to Explore
srisubrahmanyaswamydevalayamskandagiri.org
stevegrunwell.com
storemander.com
studytours.pl
syrianex.blogspot.com
tagen5.com
teamco.work
tech-in-a-flash.myshopify.com
telugudj.in
tga-arsh.ir
oxymed.cz
painart.cz
Spiur.com Valuation
US$339,596
Last updated: Dec 24, 2020

Spiur.com has global traffic rank of 422,016 and ranks the 10,860th in Iran. Its global rank has gone up by 231,080 positions since 3 months ago. Spiur.com has an estimated worth of US$ 339,596, based on its estimated Ads revenue. Spiur.com receives approximately 7,473 unique visitors each day. Its web server is located in United States, with IP address 104.27.158.84. According to SiteAdvisor, spiur.com is unknown to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$339,596
Daily Ads Revenue US$186
Monthly Ads Revenue US$5,582
Yearly Ads Revenue US$67,919
Daily Unique Visitors 7,473
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 422,016
Delta (90 Days) ⬆️ 231,080
Most Popular In Country Iran
Country Rank 10,860
DNS Records
Host Type TTL Data
spiur.com A 299 IP: 104.27.158.84
spiur.com A 299 IP: 172.67.205.188
spiur.com A 299 IP: 104.27.159.84
spiur.com AAAA 299 IPv6: 2606:4700:3037:0:0:0:ac43:cdbc
spiur.com AAAA 299 IPv6: 2606:4700:3032:0:0:0:681b:9f54
spiur.com AAAA 299 IPv6: 2606:4700:3030:0:0:0:681b:9e54
spiur.com MX 299 Priority: 10
Target: mail.spiur.com.
spiur.com NS 21599 Target: jay.ns.cloudflare.com.
spiur.com NS 21599 Target: isla.ns.cloudflare.com.
spiur.com TXT 299 TXT: v=spf1 a mx ip4:138.201.62.173 ~all
spiur.com SOA 3599 MNAME: isla.ns.cloudflare.com.
RNAME: dns.cloudflare.com.
Serial: 2035995353
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Thu, 24 Dec 2020 23:15:41 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d3e06a27a412b8508debf1ea18f4ee0a81608851741; expires=Sat, 23-Jan-21 23:15:41 GMT; path=/; domain=.spiur.com; HttpOnly; SameSite=Lax
Location: https://spiur.com/
Vary: User-Agent
CF-Cache-Status: DYNAMIC
cf-request-id: 0738a272ea0000155279b4f000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=SCX0tcQkido8ZRMtU5CSo8AUa6tyuMEDNYKMyr4s3ElGHIFH5mDHuAAh2aHi32KaphgN4cAFk7q%2FSnXlZtyr15YgTnJLlNuF3DoMCa9AUDH4trFv2Cc%3D"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 606e0697d9f81552-EWR

HTTP/2 200 
date: Thu, 24 Dec 2020 23:15:41 GMT
content-type: text/html; charset=UTF-8
set-cookie: __cfduid=dd36f98b5524e13d5a2b46d8d96d5158f1608851741; expires=Sat, 23-Jan-21 23:15:41 GMT; path=/; domain=.spiur.com; HttpOnly; SameSite=Lax
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate
pragma: no-cache
link: <https://spiur.com/wp-json/>; rel="https://api.w.org/"
link: <https://spiur.com/wp-json/wp/v2/pages/1589>; rel="alternate"; type="application/json"
link: <https://spiur.com/>; rel=shortlink
x-litespeed-cache: hit
vary: Accept-Encoding,User-Agent
cf-cache-status: DYNAMIC
cf-request-id: 0738a273af0000f05158093000000001
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=jI%2BIJhOp%2F8iR7Db5jp3Zm6w53o6xm%2BfpB%2FNL2taNZG8MNz9XuxqQdbikZ%2BYbfYuZnzsHP2H2Dgyp%2FsaTEpg8YpGHT9tOECQsux5WW25w0KUgzt93Ua4%3D"}],"group":"cf-nel","max_age":604800}
nel: {"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 606e06991d1ff051-EWR

Spiur.com Whois Information
   Domain Name: SPIUR.COM
   Registry Domain ID: 2366316969_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.joker.com
   Registrar URL: http://www.joker.com
   Updated Date: 2020-12-18T10:19:23Z
   Creation Date: 2019-03-05T14:01:08Z
   Registry Expiry Date: 2022-03-05T14:01:08Z
   Registrar: CSL Computer Service Langenbach GmbH d/b/a joker.com
   Registrar IANA ID: 113
   Registrar Abuse Contact Email: abuse@joker.com
   Registrar Abuse Contact Phone: +49.21186767447
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: ISLA.NS.CLOUDFLARE.COM
   Name Server: JAY.NS.CLOUDFLARE.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: spiur.com
Registry Domain ID: 2366316969_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.joker.com
Registrar URL: https://joker.com
Updated Date: 2020-12-18T10:19:23Z
Creation Date: 2019-03-05T14:01:08Z
Registrar Registration Expiration Date: 2022-03-05T14:01:08Z
Registrar: CSL Computer Service Langenbach GmbH d/b/a joker.com
Registrar IANA ID: 113
Registrar Abuse Contact Email: abuse@joker.com
Registrar Abuse Contact Phone: +49.21186767447
Reseller: Reseller.World
Reseller: Joker/Reseller.World
Reseller: www.Reseller.World
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Country: CA
Registrant Email: https://csl-registrar.com/contact/spiur.com/owner
Admin Email: https://csl-registrar.com/contact/spiur.com/admin
Tech Email: https://csl-registrar.com/contact/spiur.com/tech
Name Server: isla.ns.cloudflare.com
Name Server: jay.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

NOTE: By submitting a WHOIS query, you agree to abide by the following
NOTE: terms of use: You agree that you may use this data only for lawful
NOTE: purposes and that under no circumstances will you use this data to:
NOTE: (1) allow, enable, or otherwise support the transmission of mass
NOTE: unsolicited, commercial advertising or solicitations via direct mail,
NOTE: e-mail, telephone, or facsimile; or (2) enable high volume, automated,
NOTE: electronic processes that apply to Joker.com (or its computer systems).
NOTE: The compilation, repackaging, dissemination or other use of this data
NOTE: is expressly prohibited without the prior written consent of Joker.com.